PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10026666m
Common NameCARUB_v10026666mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 358aa    MW: 39390.8 Da    PI: 5.8459
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10026666mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.27.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g++R+ k+c++rw +yl
  Carubv10026666m 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLRRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding49.97.3e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ +v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Carubv10026666m  67 RGNFTEHEEKTIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-24564IPR009057Homeodomain-like
PROSITE profilePS5129426.134965IPR017930Myb domain
SuperFamilySSF466892.53E-3011108IPR009057Homeodomain-like
SMARTSM007171.0E-141363IPR001005SANT/Myb domain
PfamPF002491.8E-161461IPR001005SANT/Myb domain
CDDcd001673.55E-111661No hitNo description
Gene3DG3DSA:1.10.10.604.0E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129419.27566116IPR017930Myb domain
SMARTSM007171.7E-1566114IPR001005SANT/Myb domain
PfamPF002493.4E-1467112IPR001005SANT/Myb domain
CDDcd001678.14E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0010468Biological Processregulation of gene expression
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MGRPPCCEKV GVKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGLRRCS KSCRLRWTNY  60
LRPGIKRGNF TEHEEKTIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLKKIN  120
ESGEEDNDGG VSSSTTSSQK HHQSTNKGQW ERRLQTDINM AKQALCEALS LDKPSSTLSP  180
SSSSSLPTPA ITPQNTPTFS SALLDRCYDP SSSSSSTTTT ATTTSNTTNP YPSGVYASSA  240
ENIARLLQDF MKDTPKALTL SSSSPVSETG PLAAAVSEEG GEGFEHSFFS FNSIEETQNL  300
TQETSFFHGQ EIKPEIIMDQ DQGLISQGSL SLLEKWLFDE QSHDMVGMSL EGQVAMF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C6e-26141164105C-Myb DNA-Binding Domain
1mse_C6e-26141164105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00579DAPTransfer from AT5G62470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2289770.0AK228977.1 Arabidopsis thaliana mRNA for MYB96 transcription factor-like protein, complete cds, clone: RAFL16-28-G04.
GenBankBT0248880.0BT024888.1 Arabidopsis thaliana At5g62470 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006280703.10.0hypothetical protein CARUB_v10026666mg
SwissprotQ9SCU71e-107MYB30_ARATH; Transcription factor MYB30
TrEMBLR0EXJ50.0R0EXJ5_9BRAS; Uncharacterized protein
STRINGAT5G62470.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62470.21e-180myb domain protein 96